Question 1

What is Tesamorelin?

Accepted Answer

Tesamorelin is a research-grade compound supplied by Peptide Technologies strictly for laboratory research use only. It is offered as a lyophilized powder, quality-verified against a batch-specific third-party Certificate of Analysis (HPLC identity and purity). Tesamorelin is a reference material for in-vitro and non-clinical laboratory study. Not for use in humans or animals.

Question 2

What is Tesamorelin studied for in research?

Accepted Answer

Tesamorelin is used by laboratories as a reference compound in in-vitro and non-clinical research settings, where investigators characterise its identity, purity, and biochemical properties. Peptide Technologies supplies Tesamorelin for that research context only and makes no claims about outcomes in humans or animals. Not for use in humans or animals.

Question 3

Where can I buy Tesamorelin for research?

Accepted Answer

You can buy Tesamorelin online directly from Peptide Technologies at peptidetech.is. Every batch ships with a third-party Certificate of Analysis (HPLC purity and mass-spectrometry identity), cold-chain packaging, and lot traceability via a QR code on the vial. Peptide Technologies is a US-based research supplier that ships domestically.

Question 4

What purity is Tesamorelin and how is it verified?

Accepted Answer

Each batch of Tesamorelin is verified at ≥99% purity by RP-HPLC and confirmed for identity by mass spectrometry at an independent laboratory. The full Certificate of Analysis — purity, identity, and where applicable endotoxin — is published and linked from this product page so results can be checked before use.

Question 5

Does Tesamorelin come with a Certificate of Analysis?

Accepted Answer

Yes. Every batch of Tesamorelin ships with a batch-specific third-party COA. You can view it on this page, scan the QR code on the vial, or browse the public COA library at /coa. The COA documents lot number, HPLC purity, and identity so you can confirm the vial matches the certificate on file.

Question 6

Is Tesamorelin legal to buy for research?

Accepted Answer

Tesamorelin is sold by Peptide Technologies for laboratory research use only (RUO). It is not an approved drug, dietary supplement, cosmetic, or food. Buyers must affirm research use and accept the Terms of Sale at checkout. Not for use in humans or animals.

Question 7

Is Tesamorelin FDA approved?

Accepted Answer

No. Tesamorelin is not approved by the FDA and is not intended to diagnose, mitigate, or prevent any condition. It is supplied strictly as a research chemical for laboratory use only. Not for use in humans or animals.

Question 8

How is Tesamorelin shipped and stored?

Accepted Answer

Tesamorelin ships from the USA with cold-chain packaging to preserve stability in transit. On arrival, store the lyophilized powder per the handling notes on the Certificate of Analysis (lyophilized material is typically kept at -20°C long-term, refrigerated short-term, protected from light and moisture). Shipping windows are disclosed at checkout.

Property	Details
Product	Tesamorelin 5mg
Chemical Name	Tesamorelin (trans-3-hexenoic acid-hGRF(1–44)-NH₂)
Synonyms	TH9507, Egrifta, trans-3-hexenoic acid-GHRH(1-44)
CAS Number	218949-48-5
PubChem CID	16137828
Molecular Formula	C221H366N72O67S
Appearance	White to off-white lyophilized powder
Container	3 mL Type I glass vial; butyl stopper; flip-off seal
Purity / Identity	≥99% by HPLC; identity confirmed by MS (batch COA via on-vial QR)
Counter ION	Acetate (typical; confirm on lot COA)
Storage	−20 °C long-term; store desiccated and protected from light
Discovered Date	~2004
Intended Use	Research Use Only (RUO). Not for human or animal use.
Molecular Weight	~5135.9 Da
Amino Acid Sequence	(trans-3-hexenoic acid)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂ (44 aa)
Peptide Class	GHRH analog / Growth hormone-releasing

Tesamorelin

Tesamorelin — frequently asked questions

Related research peptides