Research peptide · Peptides
Tesamorelin
Third-party COA on file
Tesamorelin (EGRF) growth hormone-releasing factor for pituitary signaling and biochemical pathway studies. ≥99% purity with batch COA.. Each batch is HPLC-verified at an independent ISO 17025 laboratory before release, lot-traceable by the QR code on every vial.
StrengthTESAMORELIN-10MG
10 mg
$79.95
$79.95Fast shipping · in stock
1
We accept Apple Pay & Google Pay at checkout
- Free Shipment Protection on every order
- 30-day returns — unopened products Policy
- Free gifts unlock as you spend
- Lot-traceable QR on every vial
- 98%+ purity or $1,000 back *Terms apply
- HPLC-verified purity
Specifications
| Property | Details |
|---|---|
| Product | Tesamorelin 5mg |
| Chemical Name | Tesamorelin (trans-3-hexenoic acid-hGRF(1–44)-NH₂) |
| Synonyms | TH9507, Egrifta, trans-3-hexenoic acid-GHRH(1-44) |
| CAS Number | 218949-48-5 |
| PubChem CID | 16137828 |
| Molecular Formula | C221H366N72O67S |
| Appearance | White to off-white lyophilized powder |
| Container | 3 mL Type I glass vial; butyl stopper; flip-off seal |
| Purity / Identity | ≥99% by HPLC; identity confirmed by MS (batch COA via on-vial QR) |
| Counter ION | Acetate (typical; confirm on lot COA) |
| Storage | −20 °C long-term; store desiccated and protected from light |
| Discovered Date | ~2004 |
| Intended Use | Research Use Only (RUO). Not for human or animal use. |
| Molecular Weight | ~5135.9 Da |
| Amino Acid Sequence | (trans-3-hexenoic acid)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂ (44 aa) |
| Peptide Class | GHRH analog / Growth hormone-releasing |
Molecular Structure 2D
View 2D Structure on PubChem (CID 16137828)
Molecular Structure 3D
View 3D Conformer on PubChem (CID 16137828)
Related Research: What Is Tesamorelin? — structural insights and GHRH analog research. For research use only.
Tesamorelin — frequently asked questions
Research & guides




